Sign In | Join Free | My nccecojustice.org
nccecojustice.org
Products
Search by Category
Wholesale Marketplace
Home > Chemicals >

High Polymers

High Polymers

All High Polymers wholesalers & High Polymers manufacturers come from members. We doesn't provide High Polymers products or service, please contact them directly and verify their companies info carefully.

Total 2578 products from High Polymers Manufactures & Suppliers
Buy cheap 77214-82-5 Benzenesulfonic Acid 420-960-8 Orange To Brown Powder from Wholesalers

Brand Name:BeiLi

Model Number:ITX.99A.K

Place of Origin:China

77214-82-5 Benzenesulfonic Acid 420-960-8 Orange To Brown Powder Iron(III) p-Toluenesulfonate Description Iron(III) p-Toluenesulfonate, also known as Iron(III) p-toluenesulfonate hexahydrate, its ...

BeiLi Chemicals (Zhangjiagang) Co., Ltd.
Verified Supplier

Jiangsu

Buy cheap Polyaspartic flooring resin F420 from Wholesalers

Brand Name:Zhuhai Feiyang Novel Materials

Model Number:F420

Place of Origin:Zhuhai, China

FEISPARTIC F420 Polyaspartic Ester Resin ⅠChemical formula and molecular weight ● Chemical Name: Polyaspartic Ester Resin, Aspartic Acid, N,N'-(methylenedi-4,1-cyclohexanediyl)bis-,1,1',4,4'...

Shenzhen Feiyang Protech Corp., Ltd.
Site Member

Guangdong

Buy cheap QTP6016 Rail Tower Crane Undercarriage Mobile Base Foundation Type 10TONS from Wholesalers

Brand Name:HYCM

Model Number:QTZ125(PT6016) Mobile Tower Crane

Place of Origin:China

QTP6016 Rail Tower Crane Undercarriage Mobile Base Foundation Type 10TONS Features of QTZ125 PT6016 Mobile Tower Crane QTZ 125 PT6016 Mobile Tower Crane is a new type of construction tower equipment ...

Jinan Huiyou Construction Machinery Co., Ltd-HYCM Tower Crane
Site Member

Shandong

Buy cheap ABB 3HAC17345-1 new and original factory anti-static bag with individual sealed inner box from Wholesalers

Brand Name:ABB

Model Number:3HAC17345-1

Place of Origin:Switzerland

ABB 3HAC17345-1 We are the supplier for industrial automation spare parts.We specialize in PLC module, DCS card pieces, ESD system card pieces, vibration monitoring system card pieces, steam turbine ...

N.S.E. Automation Co.,Ltd
Active Member

Buy cheap Bodybuilding Anabolic Steroids DHEA Dehydroisoandrosterone 3 Acetate CAS 853-23-6 from Wholesalers

Brand Name:LSW

Model Number:853-23-6

Place of Origin:China

Bodybuilding Anabolic Steroids DHEA Dehydroisoandrosterone 3 Acetate CAS 853-23-6 Description: Acetate Dehydroepiandrosterone (DHEA) Synonyms: dehydroisoandrosterone 3-acetate; Epiandrosterone Acetate...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap TMT Blend 375 injecting anabolic steroids No Side Effect Cutting Cycle Steroids from Wholesalers

Brand Name:Jiaye

Model Number:liquid-28

Place of Origin:China

TMT Blend 375 injecting anabolic steroids , No Side Effect Cutting Cycle Steroids 1. Basic Info Tmt Blend 375: Trenbolone Enanthate 125mg/ml Drostanolone Enanthate 125mg/ml Testosterone Enanthate ...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Buy cheap 25I-NBOMe cas 919797-19-6 PRICE 5000USD/1KG PURITY:96% 2C-I-NBOMe,Cimbi-5, from Wholesalers

Brand Name:hiersunchem

Model Number:919797-19-6

Place of Origin:CHINA

25I-NBOMe (2C-I-NBOMe, Cimbi-5, also shortened to "25I", and colloquially referred to as "N-bomb" is a and derivative of the psychedelic 2C-I. It was discovered in 2003 by chemist Ralf Heim at the who ...

Hiersun Biotech Company Limited
Verified Supplier

Guangdong

Buy cheap spark arrester and silencer for marine main engine, spark trap, silencer with sprinkler system, silencer with spark trap from Wholesalers

Brand Name:topfar

Model Number:topfar

Place of Origin:China

Sell spark arrester and silencer, spark trap, silencer with sprinkler system, silencer with spark trap The spark arrester and silencer is widely used in exhaust gas line of main engine and auxiliary ...

Jingjiang Top Far Interntional Trading Co.,Ltd
Active Member

Jiangsu

Buy cheap Isoprenaline Hydrochloride Oral Anabolic Steroids CAS 51-30-9 Adrenoceptor Raw Drug from Wholesalers

Brand Name:Shuangbojie

Model Number:51-30-9

Place of Origin:China

Isoprenaline Hydrochloride CAS 51-30-9 Oral Anabolic Steroids Adrenoceptor Raw Drug Quick Details: Product name:Isoprenaline hydrochloride English Synonyms: 2-benzenediol,4-(1-hydroxy-2-((1-methylethy...

Zhuhai Shuangbojie Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Cutting Excess Body Anabolic Bodybuilding Steroids Andarine CAS 401900-40-1 from Wholesalers

Brand Name:Jusheng Brand

Model Number:401900-40-1

Place of Origin:China

S4 /Andarine/ Acetamidoxolutamide 401900-40-1 Cutting Excess Body Fat and Bulking Quick detail Product Name: Andarine CAS: 401900-40-1 MF: C19H18F3N3O6 MW: 441.36 Mol File: 401900-40-1.mol Melt point ...

Hubei Jusheng Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Pharmaceutical Powder 4-Chlorodehydromethyltestosterone test.Oral Turinabol CAS 2446-23-3 from Wholesalers

Brand Name:Nan Jian

Model Number:99%

Place of Origin:China

Pharmaceutical Powder 4-Chlorodehydromethyltestosterone test. Oral Turinabol CAS 2446-23-3 Basic Inf: Chemical Name: 4-Chlorodehydromethyltestosterone Trade Name: Oral Turinabol CAS: 2446-23-3 Assay: ...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Buy cheap Hexarelin Examorelin Fat Burning Peptides , Natural Growth Hormone For Weight Loss from Wholesalers

Brand Name:Biofriend

Model Number:140703-51-1

Place of Origin:Wuhan

Hexarelin Examorelin Fat Burning Peptides , Human Growth Hormone Peptide for Weight Loss Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-histidyl-2-methyl-D-tryptophyl...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap DSIP 2mg Delta Sleep Inducing Peptide For Bodybuilding Mass Muscle from Wholesalers

Brand Name:BestSteroid

Model Number:2mg

Place of Origin:Hubei,China

Growth Hormone Peptides DSIP 2mg Powder Delta Sleep Inducing Peptide DSIP Basic Info Name: DSIP Alias Delta Sleep Inducing Peptide CAS 62568-57-4 Sequence TRP-ALA-GLY-GLY-ASP-ALA-SER-GLY-GLU MF ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap White Sphere Activated Alumina Catalyst Support Balls For Ethylene And Propylene from Wholesalers

Brand Name:Jiulong

Model Number:Jiulong-SSZ-13

Place of Origin:China

White sphere activated alumina catalyst carrier Activated alumina, there are many micro-paths, so the specific surface is large. It can be used as absorbent, desiccant and catalyst carrier. It is also ...

Zibo  Jiulong  Chemical  Co.,Ltd
Verified Supplier

Shandong

Buy cheap Medical Sex Steroid Hormones Sildenafil Mesylate For Male Sex Enhancer from Wholesalers

Brand Name:Guangzhou Huao

Model Number:CAS139755-91-2

Place of Origin:Guangzhou China

Sex Steroid Hormones Pure Sildenafil Mesylate Powder for Male Erectile Dysfunction Sildenafil Mesylate Basic Info: CAS: 139755-91-2 Assay: 99% min. Molecular Formula: C22H30B6O4S. CH3SO3H Molecular ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap white powder 2 mg/vial  Peptide CJC 1295 Without DAC for muscle building 863288-34-0 from Wholesalers

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; CJC-1295 Acetate;CJC1295 with out DAC CAS NO ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap High Effect Clonazolam White Crystalline Powder Formula C22H25FN4O2 Standard from Wholesalers

Brand Name:CY

Model Number:research

Place of Origin:Hebei

high effect Clonazolam Clonazolam Clonazolam powder with good quality basic information of Clonazolam CAS: 731232-23-1 Formula: C22H25FN4O2 Molecular weight 396.460 Compound purity: > 99.7% Appearance...

Chiyang Biological Technology Co., Limited
Verified Supplier

Hebei

Buy cheap A5 Plastic Melamine Dinnerware Melamine Moulding Compound Food Grade Raw Material from Wholesalers

Brand Name:Yuyao Shunji

Model Number:7008

Place of Origin:Yuyao

A5 Plastic Melamine Dinnerware Melamine Moulding Compound Food Grade Raw Material Physical Property: Melamine moulding powder is based on melamine-formaldehyde resins fortified with high-class ...

Yuyao Shunji Plastics Co., Ltd
Verified Supplier

Zhejiang

Buy cheap Adrenergic Blocker Tolazoline Hydrochloride CAS 59-97-2 Raws Orally Pills from Wholesalers

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Adrenergic Blocker Tolazoline Hydrochloride CAS 59-97-2 Raws Orally Pills Product Name: Tolazoline hydrochloride Synonyms: BENZIDAZOL HYDROCHLORIDE;BENZAZOLINE HYDROCHLORIDE;2-BENZYL-4,5-IMIDAZOLINE ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap Pharmaceutical Intermediate Adrafinil Nootropic Supplements CAS 63547-13-7 for Healthy Brain Enhancin from Wholesalers

Brand Name:GC

Model Number:63547-13-7

Place of Origin:China

Quick Detail: Adrafinil Name: Adrafinil Adrafinil Synonyms: 2-((diphenylmethyl)sulfinyl)-acetohydroxamicaci; 2-((diphenylmethyl)sulfinyl)-n-hydroxy-acetamid; 2-((diphenylmethyl)sulfinyl)-n-hydroxyacet...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Go to Page
Inquiry Cart 0