Sign In | Join Free | My nccecojustice.org
nccecojustice.org
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Projects >

Injectable Peptides Bodybuilding

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    injectable peptides bodybuilding

    All injectable peptides bodybuilding wholesalers & injectable peptides bodybuilding manufacturers come from members. We doesn't provide injectable peptides bodybuilding products or service, please contact them directly and verify their companies info carefully.

    Total 7995 products from injectable peptides bodybuilding Manufactures & Suppliers
    Wholesale Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial from china suppliers

    Brand Name:HKB

    Model Number:62031-54-3

    Place of Origin:China

    Mechano Growth Factor Bodybuilding Injectable Peptide Mgf 2Mg / vial Cas No:62031-54-3 Unit Size :2 mg/vial HPLC purity:98% SDS-PAGE purity:98%. Synonyms: MGF, Mechano Growth Factor, IGF-1Ec Molecular Formula : C121H200N42O39 Molecular Weight :2948.15 Sequence :PEG-Suc-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-D-Arg-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 Appearance :White Powder Source :Chemical Synthesis Storage :Lyophilized Peg MGF is stable at room temperature for 90 days...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale 98% Human Growth Peptides AICAR 2627-69-2 Powder For Bodybuilding from china suppliers

    Brand Name:Yuancheng

    Model Number:2627-69-2

    Place of Origin:Wuhan,Hubei

    98% AICAR Raw Peptide AICAR CAS2627-69-2 Powder for Body-building CAS:2627-69-2 Purity:98% Appearance:white powder M.W.:258.231 M.F.:C9H14N4O5 Packing:10g/foil bag AICAR Storage: Before reconstitution (lyophilized / freeze dried powder): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 36 months. Can be stored at room Temperature (up to 37°C = 99°F) for 90 days. After reconstitution (liquid): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 5 days. AIRCAR, also

    Hangzhou Fuluo Biological Technology Co.,Ltd.
    Verified Supplier

    Zhejiang

    Wholesale CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding from china suppliers

    Brand Name:BestSteroid

    Model Number:863288-34-0

    Place of Origin:Hubei,China

    Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding CJC-1295 Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular Formula C152H252N44O42 One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Physical Apperance white powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as ...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 CAS Number 80449-31-6 Molecular Formula C13H16O3 Molecular Weight 751.9 N-terminal Sequence Gly30 specification 1mg/vail / 2mg/vail Assay 99.5% Appearance White powder Follistatin-344 Description Additional scientific study that has been conducted on animal test subjects has also determined that Follistatin 344 acts as an antagonist to myostatin;

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale 98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial from china suppliers

    Brand Name:YIHAN

    Model Number:PEG-MGF

    Place of Origin:China

    98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial Pegylated Mechano Grow Factor Peptides Hormones Pegylated MGF PEG MGF Pegylated Mechano Grow Factor Peptides Hormones Product name PEG MGF Other name Pegylated Mechano Grow Factor, Pegylated MGF CAS number N/A sjgbolic Molecular formula C121H200N42O39 Molecular weight 2867.2 Assay( Puriy) Above 98% Usage PEG MGF(Pegylated Mechano Grow Factor) As Peptides Hormones Promote your body releases a pulse of an MGF splice ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF from china suppliers

    Brand Name:kafen

    Model Number:HGH-Eptifibatide

    Place of Origin:Guangzhou,China

    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 2 . Description PEGylation is the act of attaching a Polyethylene glycol (PEG) structure to another larger molecule (in this case, MGF). The PEG acts as a protective coating and the theory here is .

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale CAS 170851-70-4  Peptides Powder Bodybuilding  CJC-1295 With DAC ISO9001 Standard from china suppliers

    Brand Name:Yuancheng

    Model Number:170851-70-4

    Place of Origin:China

    CAS 170851-70-4 Injectable Peptides Bodybuilding Pharmaceutical CJC-1295 With DAC CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.853 Assay: 99% Peptide Hormone 2mg/vial CJC-1295 with DAC Bodybuilding Supplements Quality testing: All the steroids only be shipped out before tested in university and lab here. Use Guidance: CJC-1295 is most suited to instances where an individual wishes to inject infrequently and is seeking substantive support for GH production rather than a maximum or near-maximum ...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Melanotan II CAS 121062-08-6 for Sexual Dysfunction Treatment from china suppliers

    Brand Name:YC

    Model Number:CAS NO.: 121062-08-6

    Place of Origin:China

    Melanotan II CAS 121062-08-6 Injectable Peptides Bodybuilding For Sexual Dysfunction Treatment Quick Details: * Product name: Melanotan-II/ MT-2* Synonyms: melanotan; Melanotan-II; MT-II* CAS No.: 121062-08-6* Grade: Pharmaceutical Grade * Molecular Formula: C50H71N15O10* Molecular Weight: 1042.1932* Assay: 99%* Packing: 2mg/vial, quantity according to customer\'s detail requirements.* Melting point: 2℃* Boiling point: 225℃* Appearance: White crystalline powder. * Storage: Closed, below 2 ~ 8℃ .

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 from china suppliers

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:China

    Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 Hexarelin Product Name Hexarelin Sequence Cas No. 140703-51-1 Molecular Formula C47H58N12O6 Molecular Weight 887.0 Appearance White Powder IR spectrum in accordance Action Due to Hexarelin’s ability to increase secretion of natural Growth Hormone, most of its effects are similar to those of synthetic GH, although to a slightly lesser extent. Effects of its use include: increase in strength, growth of new muscle fibers, .

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale MT-1 Injectable HGH Peptides Bodybuilding   75921-69-6 Melanotan I from china suppliers

    Brand Name:Steroid(Saichuang)

    Model Number:99

    Place of Origin:China

    MT-1 Injectable HGH Peptides Bodybuilding 75921-69-6 Melanotan I MT-1 White Lyophilized Melanotan muscle gain steroids Peptide Powder MT 1 MT-1 White Lyophilized Peptide Hormone Powder Melanotan I Melanotan I Melanotan II GHRP-2 GHRP-6 CJC1295 DAC-CJC1295 MGF PEG-MGF fragment177-191 fragment 176-191AOD PT141 Sermorelin Hexarelin Ipamorelin EGF MT-1 Basic Info. MT 1 Model No.: Melanotan I 10mg/vial, 100vial/kit Melanotan Export Markets: Global Melanotan I Product Description Melanotan I : 75921..

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 from china suppliers

    Brand Name:YUANYANG

    Model Number:CAS: 158861-67-7

    Place of Origin:CHINA

    High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1.333g/cm3 Boiling Point: 1407°C at 760 mmHg Storage Temperature: 20°C Refractive index: 1.664 Purity (HPLC): 98.0%min. Appearance: White powder Single Impurity (HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content (N%): ≥80.0% Water Content(Karl Fischer): ≤6.0% Acetate Content (HPIC): ≤12.0% Description: ..

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Injectable Peptides Bodybuilding CJC-1295 With DAC 2mg/Vial For Increase GH from china suppliers

    Brand Name:anabolic-oral steroids

    Model Number:CJC1295

    Place of Origin:China

    Injectable peptides Steroids CJC1295 / CJC-1295 with DAC 2mg/vial for Increase GH with Colorful Tops CJC-1295 How to use CJC 1295 is provided in vials containing 2 mg of lyophylized powder, though the amount can vary. The contents should be reconstituted by adding a convenient amount of sterile or bacteriostatic water. If for example 2 mL is chosen and the dosing of the vial is 2 mg, the resulting solution then has a concentration of 1 mg/mL, or 1000 mcg/mL. At time of dosing, an insulin syringe

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 from china suppliers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% of theoretical Peptide Content(N%): 80%(by %N) Water Content(Karl Fischer): 6.0% Acetate Content(HPIC): 15.0% MS(ESI): N/A Mass Balance: 95.0~105.0% Payment & Shipping Terms: Mini Order: 10 vials Price: Negotiable Packaging Details: Super discreet to ensure

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor from china suppliers

    Brand Name:BOF

    Model Number:N/A

    Place of Origin:China

    PEG MGF Peptide Injections Bodybuilding PEGylated Mechano Growth Factor​ Basic View: 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 Brief Introduction: 1. PEG-MGF, or PEGylated Mechano Growth Factor is a new and innovative form of MGF that outperforms natural MGF many times over. MGF is a splice variant of the IGF gene which increases stem cell

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids from china suppliers

    Brand Name:Shanghai Stero

    Model Number:BPC-157

    Place of Origin:China

    Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids What Does BPC-157 Do? BPC-157 surprisingly has no side effects, and it has been shown in a study to restore tendons, muscles, intestines, teeth, bones, etc. In in vivo studies for humans and rodents, as well as with oral or injectable subcutaneous or intramuscular injection . BPC-157 Was Shown 1, Stimulate the tendon and ligament healing as a result of the growth of tendons, cell survival and cell migration in the model of ..

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Wholesale Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building from china suppliers

    Brand Name:Gear Steroids

    Model Number:87616-84-0

    Place of Origin:CHINA

    Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other Name: Ghrp-6 Acetate Function: for Weight Loss Storage: Keep Cold Form: White Frozen Dry Powder Type: Raw Material Transport Package: Vial Origin: Shanghai,China Powder: Yes Certification: GMP, SGS, ISO 9001, USP, BP Discount:Available For Big Quantity Product Name: Ghrp-6 CAS: 87616-84-0 Place of Origin: Shanghai Shelf Life: 2 Years ..

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Wholesale Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder from china suppliers

    Brand Name:purity

    Model Number:129954-34-3

    Place of Origin:china

    Human Growth Peptide Hormone Injection Selank Raw Powder for Bodybuilding Quick detail Chemical Name : Selank Selank CAS Number : 129954-34-3 Selank Molecular Formula : C33H57N11O9 Selank Molecular Weight 751.9 Selank specification: 2mg/vail / 10mg/vail Selank Assay : 99.5% Selank Appearance : White powder Selank Description Selank is a nootropic, anxiolytic peptide based drug developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. Selank is a heptapeptide with the .

    Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
    Verified Supplier

    Hunan

    Wholesale Human Growth Hormone Peptides Bodybuilding IGF - 1 LR3 Peptide Injection 946870-92-4 from china suppliers

    Brand Name:Blue Dragon

    Model Number:IGF-1 LR3 (1mg)

    Place of Origin:China Manufacturer

    95% IGF-1 LR3 1mg Growth Hormone Peptides 946870-92-4 LR3 IGF1 Human 1, IGF-1 LR3 (1mg) Introduction: Product name: IGF-1 LR3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1, LR3 IGF1 Human IGF-1 LR3 Specification: 1mg per vial IGF-1 LR3 CAS#: 946870-92-4 IGF-1 LR3 Physical Appearance: Sterile Filtered White Lyophilized (freeze-dried) Powder IGF-1 LR3 Source: Escherichia Coli IGF-1 LR3 Purity: Greater than 90.0% as ...

    Zhuhaishi Shuangbojie Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides for Bodybuilding Whiter Powder from china suppliers

    Brand Name:Yvonne

    Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial

    Place of Origin:China

    Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides Bodybuilding Product Details: Product Name Gonadorelin Acetate Also known as Gonadorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type Injection Supplying Form Lyophilized Powder In Vials / Pure Raw Powder No Vial Custom Supported. ①. Various Colors of Flip off Caps ②. 2mg/vial , 5mg/vial, 10mg/vial , or no vials . ③. Peptides Blend According to Your Demand. such as CJC

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hubei

    Wholesale Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth from china suppliers

    Brand Name:LANDMARK

    Model Number:HPLC verfied

    Place of Origin:CHINA

    Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth 1. Drostanolone Enanthate Alias: Drostanolone; Drolban; Masteron-E, Masteron Enanthate CAS NO.: 472-61-145 Molecular formula: C27H44O3 Molecular weight: 416.64 Characters: White powder . Melting point: 65℃—68℃ Half life: 8-10 days Detection time: 3months 2. Description Masteron Enanthate is the anabolic steroid that is slow acting, but is acts for longer period of time. In fact, Masteron

    Landmark Nutraceuticals Co., Limited
    Verified Supplier

    Hongkong

    Wholesale Injectable Peptides Bodybuilding , Fat Loss Peptides For Pharmaceutical Intermediates from china suppliers

    Brand Name:DW

    Model Number:87616-84-0

    Place of Origin:China

    Growth Hormone Peptides GHRP-6 CAS 87616-84-0 For Muscle Increasement Quick Details: Product Name:GHRP-6 (Growth Hormone Releasing Peptide 6) CAS: 87616-84-0 MF: C46H56N12O6 MW: 873.01 Purity (HPLC): 98.0%min. Appearance: White powder Usage: Pharmaceutical intermediates. COA: Product Name GHRP-2 Acetate Sequence Cas No. 158861-67-7 Molecular Formula C45H55N9O6 Molecular Weight 818.0 Purity (HPLC) 98.0%min. Appearance White powder Single Impurity (HPLC) 1.0%max Amino Acid Composition ±10% of ...

    Doublewin Biological Technology Co., Ltd.
    Verified Supplier

    Guangxi

    Wholesale Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 from china suppliers

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:China

    ...Hexarelin Peptide White Powder Injectable Peptides Bodybuilding 140703-51-1 Hexarelin Product Name Hexarelin Sequence Cas No. 140703-51-1 Molecular Formula C47H58N12O6 Molecular ...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 from china suppliers

    Brand Name:YUANYANG

    Model Number:CAS: 158861-67-7

    Place of Origin:CHINA

    ...High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1....

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building from china suppliers

    Brand Name:Gear Steroids

    Model Number:87616-84-0

    Place of Origin:CHINA

    ...Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other ...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Wholesale High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 from china suppliers

    Brand Name:Biofriend

    Model Number:51 - 28 - 5

    Place of Origin:China

    ...High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 Muscle building Steroids Product Name:2, 4-Dinitrophenol Alias: DNP DNP ...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 from china suppliers

    Brand Name:Muscle Bodybuilding

    Model Number:CAS 51-28-5

    Place of Origin:China

    ...DNP 2, 4-Dinitrophenol Bodybuilding Prohormones CAS 51-28-5 For Fat Burning Product Name:2, 4-Dinitrophenol Alias: DNP DNP CAS No: ...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF from china suppliers

    Brand Name:kafen

    Model Number:HGH-Eptifibatide

    Place of Origin:Guangzhou,China

    ...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Injectable Peptides Bodybuilding CJC-1295 With DAC 2mg/Vial For Increase GH from china suppliers

    Brand Name:anabolic-oral steroids

    Model Number:CJC1295

    Place of Origin:China

    ...Injectable peptides Steroids CJC1295 / CJC-1295 with DAC 2mg/vial for Increase GH with Colorful Tops CJC-...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale Tesamorelin Fat Burning Peptides / 99% Purity Injectable Peptides Bodybuilding from china suppliers

    Brand Name:nanjian

    Model Number:2mg/Vial

    Place of Origin:China

    ...99% Purity China lab Bodybuilding Peptide Tesamorelin Product Description Tesamorelin, 2mg/vial Sequence: C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Injectable Peptides Hormones Ipamorelin 2mg / Vial For Muscle Growth and Weight Loss from china suppliers

    Brand Name:HKYC

    Model Number:170851-70-4

    Place of Origin:HUBEI,CHINA

    ...Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Basic Info Min. Order:10 vials Port:Hong ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale Pharmaceutical TB500 Peptide Bodybuilding White Powder for Performance Enhancement from china suppliers

    Brand Name:Yvonne

    Model Number:TB500 Lyophilized Powder In Vials / Pure Raw Powder No Vial

    Place of Origin:china

    ...TB500 Peptide Bodybuilding TB -4 Fragment Thymosin Beta 4 Performance Enhancement Basic Info. Product Name TB-500 Also known as ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hubei

    Wholesale Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding from china suppliers

    Brand Name:Pharmlab

    Model Number:218949-48-5

    Place of Origin:China

    ...Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding Quick Details : CAS 218949-48-5 SYNONYMS Hex-hGRF, ThGRF(1-44), TH-9507, (Hexenoyl trans-3)-hGRF(1-...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 from china suppliers

    Brand Name:YIHAN

    Model Number:IGF-1 LR3

    Place of Origin:CHINA

    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS No.:946870-...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder from china suppliers

    Brand Name:purity

    Model Number:129954-34-3

    Place of Origin:china

    ...Human Growth Peptide Hormone Injection Selank Raw Powder for Bodybuilding Quick detail Chemical Name : Selank Selank CAS Number : 129954-34-3 Selank Molecular Formula : C33H57N11O9 Selank ...

    Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
    Verified Supplier

    Hunan

    Wholesale 5mg GHRP-6 Peptide Steroid Hormones GHRP For Muscle Growth Injectable Peptide from china suppliers

    Brand Name:Zhenxiang

    Model Number:GHRP-6

    Place of Origin:CHINA

    ...5mg GHRP-6 Peptide Steroid Hormones GHRP For Muscle Growth Injectable Peptide Quick Detail; Name;GHRP-6 Name;Growth hormon releasing peptide-6 CAS;87616-84-0 Molecular Formula;C46H56N12O6 Molecular Weight; 873.01 specification;5mg/vail or...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Wholesale Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth 170851-70-4 from china suppliers

    Brand Name:wumeitech

    Model Number:CAS 77591-33-4 Pure Lab Peptides Thymosin Beta 4 /Tb500/Tb-500 Basic Info Port:China Production Capacity:50000pieces/Year Payment Terms: T/T,Western Union, Money Gram Model NO.: 77591-33-4 Customized: Customized Suitable for: Adult Purity: >97% Appearanc

    Place of Origin:China

    ...Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Basic Info Min. Order:10 vials Port:hongkong ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF from china suppliers

    Brand Name:kafen

    Model Number:HGH-Eptifibatide

    Place of Origin:China

    ...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1. Basic info. Product Name: MGF Synonyms: PEG MGF Sequence: ...

    Guangzhou Kafen Biotech Co.,Ltd
    Active Member

    Guangdong

    Go to Page
    Inquiry Cart 0