Sign In | Join Free | My nccecojustice.org
nccecojustice.org
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Elementary Substance >

Ghrp 6 Cjc 1295 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    ghrp 6 cjc 1295 dosage

    All ghrp 6 cjc 1295 dosage wholesalers & ghrp 6 cjc 1295 dosage manufacturers come from members. We doesn't provide ghrp 6 cjc 1295 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 4257 products from ghrp 6 cjc 1295 dosage Manufactures & Suppliers
    Wholesale  from china suppliers

    Brand Name:steriodshow

    Model Number:CJC-1295(Without DAC) CAS 863288-34-0

    Place of Origin:china manufactuer

    ...CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    .../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Gear Steroids

    Model Number:87616-84-0

    Place of Origin:China

    ...-0 Customized: Customized Suitable for: Adult Purity: >99% Cjc-1295 Without Dac Other Name: Cjc-1295 Without Dac Cjc-1295 Without Dac CAS: 87616-84-0 Cjc-1295 Without Dac MW: 873.01 Cjc-1295 Without Dac Appearance: White Lyophilized Powder Specification...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Wholesale  from china suppliers

    Brand Name:CJC-1295 Without DAC

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their action in the ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Sendi

    Model Number:CJC-1295 With DAC

    Place of Origin:China

    ... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What is CJC-1295? 1. Cjc-1295 is...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:ChineseHormone

    Model Number:CAS 863288-34-0

    Place of Origin:China

    ...Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: CJC 1295 without DAC is a 30 amino acid peptide hormone, better known in the community as a GHRH (...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:Grand Uni or OEM

    Model Number:CAS:863288-34-0

    Place of Origin:China

    ...CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection Quick Detail : CJC-1295 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-...

    GRAND UNIVERSE INDUSTRIAL LIMITED
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:China

    ...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:PEPTIDE POWDER

    Place of Origin:HUBEI,CHINA

    ...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale  from china suppliers

    Brand Name:Pharmlab

    Model Number:CJC 1295

    Place of Origin:China

    ...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:HBU

    Model Number:51753-57-2

    Place of Origin:CHINA

    ...99% Purity Cjc-1295 with Dac for Fat Burning 2mg / Vial Cjc-1295 with Dac Cjc-1295 with Dac CAS:51753-57-2 Other Name:Grf 1-29 Purity (HPLC):98% MF: C165H271N47O46 MW: ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:China

    ...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:Biofriend

    Model Number:87616-84-0

    Place of Origin:China

    ...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Muscle Man

    Model Number:863288-34-0

    Place of Origin:China, Hunan

    ...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Wholesale  from china suppliers

    Brand Name:CJC 1295

    Model Number:CAS 863288-34-0

    Place of Origin:China

    ...Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their action ...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Wholesale  from china suppliers

    Brand Name:N/A

    Model Number:CJC 1295

    Place of Origin:China

    ...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

    Zhongweiye Biological Technology
    Site Member

    Hebei

    Wholesale  from china suppliers

    Brand Name:steroidphar

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Active Member

    Guangdong

    Wholesale  from china suppliers

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0