Sign In | Join Free | My nccecojustice.org
nccecojustice.org
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Massager >

Cjc 1295 Ghrp 6 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 ghrp 6 dosage

    All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 5578 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
    Wholesale CAS 863288-34-0 Peptides Steroids Powder Cjc-1295 No Dac for Muscle Enhance from china suppliers

    Brand Name:HKYC

    Model Number:PEPTIDE POWDER

    Place of Origin:HUBEI,CHINA

    ...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 from china suppliers

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:China

    ...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale Injectable Growth Hormone Peptides Bodybuilding CJC 1295 With DAC from china suppliers

    Brand Name:YUANHANG

    Model Number:/

    Place of Origin:CHINA

    ...Polypeptide Hormones CJC-1295 DAC Peptide 2mg/vial Bodybuilding Supplements CJC-1295 With DAC Abstract CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone releasing ...

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale CJC 1295 DAC Human Growth White Peptide Powder 2mg CJC1295 With DAC from china suppliers

    Brand Name:JNJG

    Model Number:CJC-1295 with DAC

    Place of Origin:CHINA

    ...CJC 1295 DAC Human Growth White Peptide Powder 2mg CJC1295 With DAC Quick Detail: other name CJC1295dac, CJC1295withDAC Product Description CJC-1295 2mg/Vial Standard Medicine Grade MF C165H271N47O46 Molecular Weight 3649.30 Purity...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale 2mg / vial Bodybuilding Steroids 99.5% CJC-1295/DAC White Powder Peptide CAS 863288-34-0 from china suppliers

    Brand Name:muscle man

    Model Number:Cas No: 863288-34-0 

    Place of Origin:China

    ... Powder CJC-1295 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC) Cas No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% HPLC: CJC-1295 DAC vs. CJC-1295 No DAC CJC-1295 DAC and CJC-1295 (also...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale Polypeptides Hormone Powder CJC - 1295 Injection 2mg Per Vial Hormone Increase from china suppliers

    Brand Name:Shanghai Stero

    Model Number:CJC - 1295

    Place of Origin:China

    ... be released in pulses. In fact, this is partly the reason why CJC-1295 works much better when stacked with GHRP as well. Modified GRF 1-29 is also known as Mod GRF 1-29...

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Wholesale 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac from china suppliers

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Human Growth Peptides Cjc-1295 Increasing Protein Synthesis Powder CAS: 863288-34-0 from china suppliers

    Brand Name:YIHAN

    Model Number:YH-cjc

    Place of Origin:China

    ...-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 without DAC, CJC 1295 w/o DAC CAS No.: 863288-34-0

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale 2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder from china suppliers

    Brand Name:Shanghai Stero

    Model Number:Cjc1295

    Place of Origin:China

    ... Without Dac Cjc1295 Dac CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a growth hormone releasing hormone (GHRH) analog. Clinical Research was first conducted for CJC-1295 during the mid-2000s...

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Wholesale CJC-1295 Wwithout DAC Peptide Hormones Bodybuilding Inhibitor Modified GRF 1-29 2mg / vial from china suppliers

    Brand Name:LSW

    Model Number:CJC-1295 without DAC

    Place of Origin:China

    ... water or 1% acetic acid Packing 2mg/vial. 5mg/vial 10mg/vial 10 vials/box Description: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hubei

    Wholesale White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles from china suppliers

    Brand Name:Pharmlab

    Model Number:CJC 1295

    Place of Origin:China

    ...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale CJC-1295 with DAC Anti Aging CJC-1295 Peptide Hormones Acetate Growth Steroid from china suppliers

    Brand Name:steriodshow

    Model Number:863288-34-0

    Place of Origin:china manufactuer

    ...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale Long - half Life Human Peptide 2mg/vial CJC-1295 Dac Injury Recovery Cellular Repair from china suppliers

    Brand Name:Hong Kong Blue

    Model Number:CJC 1295 DAC

    Place of Origin:China

    .../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale Injectable Anabolic Steroids Peptide CJC-1295 DAC  With DAC Lyophilized Powder from china suppliers

    Brand Name:Kafen

    Model Number:863288-34-0

    Place of Origin:China

    ...Sell High Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC With DAC Lyophilized Powder Basic Info. other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production from china suppliers

    Brand Name:Rund

    Model Number:CAS 863288-34-0

    Place of Origin:China

    ...Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Details: Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-...

    3M Biotech Co., Ltd
    Verified Supplier

    Wholesale Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 from china suppliers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Bodybuilding Peptides Mix Ghrp-6 (1mg) plus Ipamorelin (1mg) plus Cjc 1295 (1mg) plus Mgf (500mcg) from china suppliers

    Brand Name:Biofriend

    Model Number:87616-84-0

    Place of Origin:China

    ...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping from china suppliers

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0