Sign In | Join Free | My nccecojustice.org
nccecojustice.org
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Organic Acid >

Cjc 1295 Ghrp 6 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 ghrp 6 dosage

    All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 3937 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
    Wholesale  from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Pharmlab

    Model Number:CJC 1295

    Place of Origin:China

    ...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Hong Kong Blue

    Model Number:CJC 1295 DAC

    Place of Origin:China

    .../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale  from china suppliers

    Brand Name:Pharmagrade Steroids

    Model Number:863288-34-0

    Place of Origin:China

    ...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building Product Descripition: CAS 863288-34-0 Appearance ...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:steroidphar

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:steriodshow

    Model Number:863288-34-0 

    Place of Origin:china manufactuer

    ...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:KANGDISEN

    Model Number:2 mg/vial

    Place of Origin:China

    ... Hormone Steroids CJC-1295 Without DAC Peptide Modified GRF (1-29), CJC-1295 no DAC Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or “ModGRF(1-29),” also known as CJC-1295 without...

    Hongkong Kangdisen Medical Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:PEPTIDE POWDER

    Place of Origin:HUBEI,CHINA

    ...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:China

    ...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:HZ

    Model Number:CAS:863288-34-0

    Place of Origin:China

    ... Growth Steroid Cjc-1295 with Dac for Muscle Enhance Quick Detail: Products Name; CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: White powder Alias: CJC-1295 Acetate...

    Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:LSW

    Model Number:CAS:51753-57-2

    Place of Origin:China

    ...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 with Dac for Muscle Enhance with reasonable price and safe delivery Quick Detail: Products Name; CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:Muscle Man

    Model Number:863288-34-0

    Place of Origin:China, Hunan

    ...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Wholesale  from china suppliers

    Brand Name:Huao(skype:mia9403)

    Model Number:CJC-1295 with DAC

    Place of Origin:China

    ...Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Quick detail : CJC 1295 With DAC Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Anabolic-Oral Steroid

    Model Number:CJC-1295

    Place of Origin:China

    ...Injectable Peptide Steroid Human Growth CJC-1295 / CJC-1295 without DAC 2mg/vial with Colorful Tops CJC-1295 Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:yuancheng

    Model Number:Cjc-1295

    Place of Origin:China

    .../vial for Muscle Gaining Basic Info: Product Name: Cjc-1295 Without Dac Model NO.: API Customized: Customized Suitable for: Elderly, Adult Purity: >98% Chemical Name: Cjc-1293 Appearance: Powder Storage: Cool&Dry Type...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Gear Steroids

    Model Number:51753-57-2

    Place of Origin:China

    ...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Wholesale  from china suppliers

    Brand Name:CJC-1295 DAC

    Model Number:CAS Number 863288-34-0

    Place of Origin:China

    ...Bodybuilding Acetate 98% CJC-1295 DAC White Powder Peptide CAS 863288-34-0 Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their action ...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Wholesale  from china suppliers

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0