Sign In | Join Free | My nccecojustice.org
nccecojustice.org
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Herb Medicine >

Cjc 1295 Ghrp 6 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 ghrp 6 dosage

    All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 4793 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
    Wholesale Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 from china suppliers

    Brand Name:HKYC

    Model Number:muscle building

    Place of Origin:HUBEI,CHINA

    ... know I will give info.in details. kathelin@yccreate.com Skype:live:kathelin_4 WhataApp:+8618872220706 Description 1.CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog.One...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale 99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac ( CJC-1295 without Dac ) from china suppliers

    Brand Name:Bodybuilding

    Model Number:CJC-1295

    Place of Origin:China

    ...99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac (CJC-1295 without Dac) Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale CJC-1295 without DAC Peptides 2mg Injectable Peptides Human Growth Hormone for bodybuilding from china suppliers

    Brand Name:Hongkong SaiChuang

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 without DAC Peptides 2mg for Muscle Gaining Injectable Peptides Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367.2 ...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial from china suppliers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg dosages Amount to Inject: If you have used...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale Peptide Steroid hormones Lyophilized Powder Cjc 1295 Without Dac for Gh Releasing from china suppliers

    Brand Name:YC

    Model Number:Cjc 1295 Without Dac

    Place of Origin:China

    ... Packing Ways for Your Choice Specification:USP28 HS Code:3001200020 Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 without DAC, CJC 1295 w/o DAC Product Description 1.CJC-1295 Peptide Profile This peptide is a GH releasing hormone (GHRH)

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Wholesale CJC -1295 Without DAC Peptide Hormones Muscle Building CAS 863288-34-0 from china suppliers

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:whatsapp: +86 138 7101 4054

    ...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac from china suppliers

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale CJC-1295 Polypeptide Hormones Peptide Raw Powder CJC-1295 DAC with 2mg from china suppliers

    Brand Name:steriodshow

    Model Number:ycwlb045@yccreate.com

    Place of Origin:china manufactuer

    ... Raw Powder CJC-1295 DAC with 2mg CJC-1295 DAC, 2mg/vial Cas No. 863288-34-0 CJC 1295 DAC, a long acting GHRH polypeptide, causes the anterior pituitary’s somatotropes to release growth hormone. DAC conjugated CJC 1295, makes this...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles from china suppliers

    Brand Name:Pharmlab

    Model Number:CJC 1295

    Place of Origin:China

    ...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale Fat Burner Human Growth Peptides Cjc 1295 Without Dac 2mg/Vial CAS 863288-34-0 from china suppliers

    Brand Name:ChineseHormone

    Model Number:863288-34-0

    Place of Origin:China

    ...Fat Burner Peptide Human Growth Cjc 1295 Without Dac 2mg/Vial CAS 863288-34-0 CJC-1295 Dosage : The available literature indicates dose of 1000 mcg administered every three days (twice a week).The ...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Wholesale Long - half Life Human Peptide 2mg/vial CJC-1295 Dac Injury Recovery Cellular Repair from china suppliers

    Brand Name:Hong Kong Blue

    Model Number:CJC 1295 DAC

    Place of Origin:China

    .../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale White Lypohilized Peptide Steroid Hormones Cjc-1295 With Dac 5mg 10mg for Muscle Mass from china suppliers

    Brand Name:JNJG

    Place of Origin:CHINA

    ...White Lypohilized Peptide Powder Cjc-1295 With Dac 5mg 10mg for Muscle Mass Introduction: CJC-1295 is a synthetic GHRH analog that selectively and covalently binds to endogenous albumin after injection, thereby ...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 from china suppliers

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:China

    ...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale Bodybuilding Peptides Mix Ghrp-6 (1mg) plus Ipamorelin (1mg) plus Cjc 1295 (1mg) plus Mgf (500mcg) from china suppliers

    Brand Name:Biofriend

    Model Number:87616-84-0

    Place of Origin:China

    ...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 from china suppliers

    Brand Name:Muscle Man

    Model Number:863288-34-0

    Place of Origin:China, Hunan

    ...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Wholesale Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder from china suppliers

    Brand Name:Huao(skype:mia9403)

    Model Number:CJC-1295 with DAC

    Place of Origin:China

    ...Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Quick detail : CJC 1295 With DAC Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale 2mg/vial CJC 1295 For Bodybuilder Without DAC , 99% puirty Peptide, white powder from china suppliers

    Brand Name:N/A

    Model Number:CJC 1295

    Place of Origin:China

    ...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

    Zhongweiye Biological Technology
    Site Member

    Hebei

    Wholesale CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping from china suppliers

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0